PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 32750
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family GATA
Protein Properties Length: 396aa    MW: 43143.6 Da    PI: 4.636
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
32750genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.43.4e-17361392132
   GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrk 32 
            C +Cgt kTp+WR gp+g+ktLCnaCG++y k
  32750 361 CLHCGTVKTPQWRMGPEGKKTLCNACGVRYMK 392
            99***************************977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577168.08E-13354392No hitNo description
SMARTSM004014.0E-6355395IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.556355390IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.109.9E-14360392IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.1E-14361392IPR000679Zinc finger, GATA-type
CDDcd002022.15E-12361390No hitNo description
PROSITE patternPS003440361386IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MGGHARARAA PGDFLGAKPS TRDFALEDLF RVDFASGDEG EGEGEKRATI DGGREGDAVR  60
AAATREAREG RAAADDWDAL ARAWDEVEAR APARDYAWEV LNSLPSVGGD IMTCKEDEMD  120
CFAYGGAHSV PYIAPEWLER PNGDVEDGVS DNEDEDEDEG DAHRFTKAMR ESSSFLLDDE  180
DEFMRTVDAP VDFITEPEAF AARREARALA RDAREPAIDF AVKSALLCGD EEEDDFSGQD  240
CSAMADESAY EFQEHFATAA DGRVFRVSSA LVTPSSSERA NVEDSANHRG LTDSEDSDAD  300
LVAHSAKKSP KLIAGSTTKR KRRPDGRGRR AKAYKKIKKD KGVCATDVYV MANGKKMRRG  360
CLHCGTVKTP QWRMGPEGKK TLCNACGVRY MKGIL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0005870.0CP000587.1 Ostreococcus lucimarinus CCE9901 chromosome 7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001418973.10.0predicted protein
TrEMBLA4S0H60.0A4S0H6_
STRINGA4S0H60.0(Ostreococcus lucimarinus CCE9901)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2201430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.15e-15GATA transcription factor 7